COX7A1 Polyclonal antibody

• 

  WB analysis of mouse heart using 11413-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11413-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 11413-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 11413-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11413-1-AP (COX7A1 antibody) at dilution of 1:100 (under 10x lens).

COX7A1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11413-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

COX7A, COX7A1, COX7AH, COX7AM

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human brain tissue, human kidney tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11413-1-AP targets COX7A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1981

  Product name: Recombinant human COX7A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC002757

  Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN

• Full Name: cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)
• Calculated Molecular Weight: 79 aa, 9 kDa
• Observed Molecular Weight: 7-9 kDa
• GenBank Accession Number: BC002757
• Gene Symbol: COX7A1
• Gene ID (NCBI): 1346
• RRID: AB_2085705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24310
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Cereb Cortex; New Cortical Neurodegenerative Pathways in the Hypertensive Rat Brain.; Authors - Ben Shabat Moti
human	WB	Lab Invest; Overexpression of COX7A1 Promotes the Resistance of Gastric Cancer to Oxaliplatin and Weakens the Efficacy of Immunotherapy; Authors - Si-Yu Wang
human	WB	J Biol Chem; PMID: 20870728; Authors - Oliva Claudia R CR
human	WB, IF	Int J Biochem Cell Biol; Investigating the role of the physiological isoform switch of cytochrome c oxidase subunits in reversible mitochondrial disease.; Authors - Veronika Boczonadi
mouse	WB	Biochim Biophys Acta Mol Cell Res; Blockade of angiotensin II modulates insulin-like growth factor 1-mediated skeletal muscle homeostasis in experimental steatohepatitis; Authors - Misako Tanaka
human	WB	Cell Death Dis; BNIP3-mediated mitophagy boosts the competitive growth of Lenvatinib-resistant cells via energy metabolism reprogramming in HCC; Authors - Sikai Wang