COX7A1 Polyclonal antibody

COX7A1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11413-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

COX7A, COX7A1, COX7AH, COX7AM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human brain tissue, human kidney tissue
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11413-1-AP targets COX7A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1981

Product name: Recombinant human COX7A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-79 aa of BC002757

Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN

Predict reactive species
Full Name cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)
Calculated Molecular Weight 79 aa, 9 kDa
Observed Molecular Weight 7-9 kDa
GenBank Accession NumberBC002757
Gene Symbol COX7A1
Gene ID (NCBI) 1346
RRIDAB_2085705
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24310
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965).

Protocols

Product Specific Protocols
IHC protocol for COX7A1 antibody 11413-1-APDownload protocol
WB protocol for COX7A1 antibody 11413-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIHC

Cereb Cortex

New Cortical Neurodegenerative Pathways in the Hypertensive Rat Brain.

Authors - Ben Shabat Moti
humanWB

Lab Invest

Overexpression of COX7A1 Promotes the Resistance of Gastric Cancer to Oxaliplatin and Weakens the Efficacy of Immunotherapy

Authors - Si-Yu Wang
humanWB

J Biol Chem

PMID: 20870728

Authors - Oliva Claudia R CR
humanWB, IF

Int J Biochem Cell Biol

Investigating the role of the physiological isoform switch of cytochrome c oxidase subunits in reversible mitochondrial disease.

Authors - Veronika Boczonadi
mouseWB

Biochim Biophys Acta Mol Cell Res

Blockade of angiotensin II modulates insulin-like growth factor 1-mediated skeletal muscle homeostasis in experimental steatohepatitis

Authors - Misako Tanaka
humanWB

Cell Death Dis

BNIP3-mediated mitophagy boosts the competitive growth of Lenvatinib-resistant cells via energy metabolism reprogramming in HCC

Authors - Sikai Wang
Loading...
||
New chat Able
正在加载,请稍候...