Published Applications
| WB | See 2 publications below |
Product Information
66062-1-Ig targets COX7A2L in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18768 Product name: Recombinant human COX7A2L protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-114 aa of BC007095 Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIIa polypeptide 2 like |
| Calculated Molecular Weight | 114 aa, 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC007095 |
| Gene Symbol | COX7A2L |
| Gene ID (NCBI) | 9167 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O14548 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Brain Pathol Mitochondrial activity in the frontal cortex area 8 and angular gyrus in Parkinson's disease and Parkinson's disease with dementia. | ||
PLoS One COX7A2L/SCAFI and Pre-Complex III Modify Respiratory Chain Supercomplex Formation in Different Mouse Strains with a Bcs1l Mutation. |
