Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11416-1-AP targets COX7A2L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1980 Product name: Recombinant human COX7A2L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC007095 Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIIa polypeptide 2 like |
| Calculated Molecular Weight | 114 aa, 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC007095 |
| Gene Symbol | COX7A2L |
| Gene ID (NCBI) | 9167 |
| RRID | AB_2245402 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14548 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX) is the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. The mitochondrially encoded subunits function in electron transfer, and the nuclear encoded subunits may function in the regulation and assembly of the complex. COX7A2L (cytochrome c oxidase subunit 7A-related protein), also known as COX7AR or COX7RP, is an inner mitochondrial membrane protein. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. Recently it was found that DNA methylation of COX7A2L had a significant association with therapy response in patients with breast cancer. In Alzheimer's disease the expression of COX7A2L was reduced.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX7A2L antibody 11416-1-AP | Download protocol |
| WB protocol for COX7A2L antibody 11416-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-COX7A2 antibody (Cat# 11416-1-AP) has 26 citations across 22 journals, including Science, Cell Metabolism, Cancer Discovery, Nature Metabolism, Nature Communications, EMBO Journal, and Cell Reports. Research fields span mitochondrial respiratory supercomplex assembly, oxidative phosphorylation, cancer biology (renal cell carcinoma, breast cancer, pancreatic cancer), cardioprotection, metabolic regulation, aging, and diabetes. Applications are predominantly Western blot, with some IHC and IF.
| Species | Application | Title |
|---|---|---|
Science Supercomplex assembly determines electron flux in the mitochondrial electron transport chain. | ||
Cell Metab Two independent respiratory chains adapt OXPHOS performance to glycolytic switch | ||
Cancer Discov Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma | ||
Nat Commun Sprint interval exercise disrupts mitochondrial ultrastructure driving a unique mitochondrial stress response and remodelling in men. | ||
EMBO J Multiple pathways coordinate assembly of human mitochondrial complex IV and stabilization of respiratory supercomplexes. |
