Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue, human hepatocirrhosis tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15368-1-AP targets COX8A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2885 Product name: Recombinant human COX8A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC063025 Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE Predict reactive species |
| Full Name | cytochrome c oxidase subunit 8A (ubiquitous) |
| Calculated Molecular Weight | 8 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC063025 |
| Gene Symbol | COX8A |
| Gene ID (NCBI) | 1351 |
| RRID | AB_10697832 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10176 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX8A antibody 15368-1-AP | Download protocol |
| WB protocol for COX8A antibody 15368-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma. | ||
J Proteomics MALDI-MS tissue imaging identification of biliverdin reductase B overexpression in prostate cancer. | ||
J Adv Res Lactational high weight loss impairs follicular development by causing mitochondrial dysfunction of ovarian cells in sows and mitigated by butyrate supplement | ||
Nat Commun A FRET-based respirasome assembly screen identifies spleen tyrosine kinase as a target to improve muscle mitochondrial respiration and exercise performance in mice | ||
Basic Res Cardiol Comparison of the stage-dependent mitochondrial changes in response to pressure overload between the diseased right and left ventricle in the rat |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Svitlana (Verified Customer) (03-01-2019) | HEK293t transfected with Cox8-eGFP, 48 hours post-transfection cells collected for mitochondria isolation. 10 ug mitochondrial lysate (in RIPA buffer) was loaded per line.Incubation with primary anti-Cox8 antibody overnight at 4C.Image: 1st line protein ladder, 2nd line no-transfection sample, 3rd line Cox8-eGFP transfected sample.
![]() |














