CPD Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00185-1

  Sandwich ELISA standard curve of MP00185-1, Human CPD Recombinant Matched Antibody Pair - PBS only. 83229-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag34646. 83229-1-PBS was HRP conjugated as the detection antibody. Range: 0.625-40 ng/mL

• 

  Sample test of MP00185-1

  HEK-293 and A431 cell lysate were measured. The human CPD concentration of detected samples was determined to be 55.8 ng/mL (based on a 1.2 mg/mL extract load) in HEK-293 cell lysate and 37.2 ng/mL (based on a 1.5 mg/mL extract load) in A431 cell lysate.

• 

  Cytometric bead array standard curve of MP00185-1

  Cytometric bead array standard curve of MP00185-1, CPD Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83229-3-PBS. Detection antibody: 83229-1-PBS. Standard: Ag34646. Range: 0.625-20 ng/mL.

CPD Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83229-3-PBS

Clone No.240196G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

carboxypeptidase D, GP180

---

Product Information

83229-3-PBS targets CPD as part of a matched antibody pair:

MP00185-1: 83229-3-PBS capture and 83229-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34646

  Product name: Recombinant human CPD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-420 aa of NM_001304

  Sequence: FDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHPIMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY

• Full Name: carboxypeptidase D
• Calculated Molecular Weight: 153 kDa
• GenBank Accession Number: NM_001304
• Gene Symbol: CPD
• Gene ID (NCBI): 1362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75976
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.