CPO Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 82952-2-RR (same clone as 82952-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 82952-2-RR (CPO antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82952-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82952-2-RR (same clone as 82952-2-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug CPO Recombinant antibody (82952-2-RR, Clone:230153F4) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82952-2-PBS in a different storage buffer formulation.

CPO Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 82952-2-PBS

Clone No.230153F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

230153F4, Carboxypeptidase O, EC:3.4.17.-

---

Product Information

82952-2-PBS targets CPO in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24059

  Product name: Recombinant human CPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-101 aa of BC112078

  Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII

• Full Name: carboxypeptidase O
• Calculated Molecular Weight: 374 aa, 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC112078
• Gene Symbol: CPO
• Gene ID (NCBI): 130749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8IVL8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.