CPO Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CPO Recombinant monoclonal antibody (82952-2-RR)

• 

  WB analysis of HeLa using 82952-2-RR

  HeLa cells were subjected to SDS PAGE followed by western blot with 82952-2-RR (CPO antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using 82952-2-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug CPO Recombinant antibody (82952-2-RR, Clone:230153F4) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CPO Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 82952-2-RR

Clone No.230153F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

230153F4, Carboxypeptidase O, EC:3.4.17.-

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82952-2-RR targets CPO in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24059

  Product name: Recombinant human CPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-101 aa of BC112078

  Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII

• Full Name: carboxypeptidase O
• Calculated Molecular Weight: 374 aa, 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC112078
• Gene Symbol: CPO
• Gene ID (NCBI): 130749
• RRID: AB_3670695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8IVL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CPO (Carboxypeptidase O) is a member of the M14 family of metallocarboxypeptidases, belonging to the CPA subfamily. It is a GPI-anchored membrane-bound enzyme highly expressed on the brush-border membrane of intestinal epithelial cells. Unlike classical digestive carboxypeptidases such as CPA and CPB, which are secreted as inactive proenzymes, CPO is synthesized as an active enzyme without a prodomain. Its most distinctive biochemical feature is a strong substrate preference for C-terminal acidic amino acids, specifically glutamate and aspartate. This specificity distinguishes CPO from other family members. Its primary physiological role is to complete the digestion of dietary proteins by releasing acidic amino acids for efficient absorption in the small intestine.