CPSF4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CPSF4 Polyclonal antibody (15023-1-AP)

• Featured Product
• KD/KO Validated

CPSF4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15023-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Cleavage and polyadenylation specificity factor 30 kDa subunit, Cleavage and polyadenylation specificity factor subunit 4, CPSF 30 kDa subunit, CPSF30, NAR

• 

  WB analysis of HEK-293 using 15023-1-AP

  WB result of CPSF4 antibody (15023-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CPSF4 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15023-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15023-1-AP (CPSF4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15023-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15023-1-AP (CPSF4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15023-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15023-1-AP (CPSF4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15023-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15023-1-AP (CPSF4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15023-1-AP

  IP result of anti-CPSF4 (IP:15023-1-AP, 3ug; Detection:15023-1-AP 1:400) with HeLa cells lysate 1000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 15023-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15023-1-AP (CPSF4 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 15023-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 15023-1-AP (CPSF4 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15023-1-AP

  Immunofluorescent analysis of HepG2 cells, using CPSF4 antibody 15023-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CPSF4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells, HeLa cells, HEK-293 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15023-1-AP targets CPSF4 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7103

  Product name: Recombinant human CPSF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC003101

  Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

• Full Name: cleavage and polyadenylation specific factor 4, 30kDa
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC003101
• Gene Symbol: CPSF4
• Gene ID (NCBI): 10898
• RRID: AB_2084544
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95639
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mature 3-prime ends of cellular mRNAs are producted by endonucleolytic cleavage of the primary transcripts, followed by polyadenylation of the upstream cleavage products. The cleavage and polyadenylation specificity factor (CPSF) has a essential role in pre-mRNA 3-prime end processing in that it is required in both the cleavage step and subsequent poly(A) addition [PMID: 9651582]. CPSF4 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex, whose other components are CPSF1, CPSF2, CPSF3 and FIP1L1.

Publications

What published studies show

The Anti-CPSF4 antibody (Cat# 15023-1-AP) has 18 citations across 16 journals including Molecular Cell, Cancer Letters, Cell Reports, EMBO Reports, PNAS, Journal of Translational Medicine, Molecular Oncology, and Scientific Reports. Research fields span cancer biology (lung, breast, colon, and hepatocellular carcinoma), RNA processing (alternative splicing and polyadenylation), transcription regulation, and molecular oncology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Mediator regulates transcriptional termination through crosstalk with pre-mRNA 3' end processing factors; Authors - Chengjiang Lu
human	WB,IHC,IF	Cancer Lett; Cleavage and polyadenylation specific factor 4 targets NF-κB/cyclooxygenase-2 signaling to promote lung cancer growth and progression.; Authors - Canhui Yi ; KD Validated
human	WB	J Transl Med; CPSF4-mediated regulation of alternative splicing of HMG20B facilitates the progression of triple-negative breast cancer; Authors - Guansheng Zhong
	WB	Proc Natl Acad Sci U S A; RNA polymerase III transcription-associated polyadenylation promotes the accumulation of noncoding retrotransposons during infection; Authors - Azra Lari
pig	WB	Int J Biol Macromol; Key pituitary miRNAs mediate the expression of pig GHRHR splice variants by regulating splice factors.; Authors - Zhaohui Teng
human	WB	Cell Rep; LINC00921 reduces lung cancer radiosensitivity by destabilizing NUDT21 and driving aberrant MED23 alternative polyadenylation; Authors - Nasha Zhang