CREB3L4 Polyclonal antibody, PBS Only

• 

  WB analysis using 13630-1-AP (same clone as 13630-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13630-1-AP (CREB3L4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13630-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 13630-1-AP (same clone as 13630-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13630-1-AP (CREB3L4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13630-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 13630-1-AP (same clone as 13630-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 13630-1-AP (CREB3L4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13630-1-PBS in a different storage buffer formulation.

CREB3L4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 13630-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13630-1-PBS targets CREB3L4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4548

  Product name: Recombinant human CREB3L4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC038962

  Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAG

• Full Name: cAMP responsive element binding protein 3-like 4
• Calculated Molecular Weight: 395 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC038962
• Gene Symbol: CREB3L4
• Gene ID (NCBI): 148327
• RRID: AB_2276550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CREB3L4 (cAMP responsive element binding protein 3-like 4), also named as AIBZIP, CREB4 and ATCE1, is a member of the CREB/ATF transcription factor family. CREB3L4 may play a role in the unfolded protein response, characterized by their regulation of gene expression through the cAMP-responsive element(PMID: 22829733). CREB3L4 is highly expressed in multiple human cancers, such as human breast carcinoma, prostate cancer(PMID: 32026099, PMID: 28338058). The molecular weight of CREB3L4 is 43 kDa and 55 kDa precursor was reported. Due to glycosylation, CREB3L4 can be observed with molecular weights of 35 and 41 kDa (PMID: 25412305, 15938716).