CREB3L4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CREB3L4 Polyclonal antibody (13630-1-AP)

CREB3L4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13630-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

cAMP-responsive element-binding protein 4, cAMP-responsive element-binding protein 3-like protein 4, Attaching to CRE-like 1, ATCE1, Androgen-induced basic leucine zipper protein

• 

  WB analysis using 13630-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13630-1-AP (CREB3L4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13630-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13630-1-AP (CREB3L4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 13630-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 13630-1-AP (CREB3L4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, HL-60 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13630-1-AP targets CREB3L4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4548

  Product name: Recombinant human CREB3L4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC038962

  Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAG

• Full Name: cAMP responsive element binding protein 3-like 4
• Calculated Molecular Weight: 395 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC038962
• Gene Symbol: CREB3L4
• Gene ID (NCBI): 148327
• RRID: AB_2276550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEY5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CREB3L4 (cAMP responsive element binding protein 3-like 4), also named as AIBZIP, CREB4 and ATCE1, is a member of the CREB/ATF transcription factor family. CREB3L4 may play a role in the unfolded protein response, characterized by their regulation of gene expression through the cAMP-responsive element(PMID: 22829733). CREB3L4 is highly expressed in multiple human cancers, such as human breast carcinoma, prostate cancer(PMID: 32026099, PMID: 28338058). The molecular weight of CREB3L4 is 43 kDa and 55 kDa precursor was reported. Due to glycosylation, CREB3L4 can be observed with molecular weights of 35 and 41 kDa (PMID: 25412305, 15938716).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	iScience; CREB3L4 promotes hepatocellular carcinoma progression and decreases sorafenib chemosensitivity by promoting RHEB-mTORC1 signaling pathway; Authors - Zhengchen Jiang ; KD Validated