Product Information
83340-1-PBS targets CRIP1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag7588 Product name: Recombinant human CRIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC002738 Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK Predict reactive species |
| Full Name | cysteine-rich protein 1 (intestinal) |
| Calculated Molecular Weight | 9 kDa |
| GenBank Accession Number | BC002738 |
| Gene Symbol | CRIP1 |
| Gene ID (NCBI) | 1396 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P50238 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

