Product Information
20914-1-AP targets CRISPLD2 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15049 Product name: Recombinant human CRISPLD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC007689 Sequence: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHN Predict reactive species |
| Full Name | cysteine-rich secretory protein LCCL domain containing 2 |
| Calculated Molecular Weight | 497 aa, 56 kDa |
| GenBank Accession Number | BC007689 |
| Gene Symbol | CRISPLD2 |
| Gene ID (NCBI) | 83716 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0B8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
