Tested Applications
| Positive WB detected in | HEK-293T cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30546-1-AP targets CRKL in WB, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30874 Product name: Recombinant human CRKL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 181-242 aa of NM_005207 Sequence: LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKA Predict reactive species |
| Full Name | v-crk sarcoma virus CT10 oncogene homolog (avian)-like |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | NM_005207 |
| Gene Symbol | CRKL |
| Gene ID (NCBI) | 1399 |
| RRID | AB_3086359 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46109 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CRKL antibody 30546-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wojciech (Verified Customer) (11-12-2025) | CRKL was detected as one clear band at 35 kDa. The antibody worked as expected.
|

