CRKL Polyclonal antibody, PBS Only

• 

  WB analysis using 30546-1-AP (same clone as 30546-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30546-1-AP (CRKL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30546-1-PBS in a different storage buffer formulation.

CRKL Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30546-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30546-1-PBS targets CRKL in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30874

  Product name: Recombinant human CRKL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-242 aa of NM_005207

  Sequence: LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKA

• Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)-like
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_005207
• Gene Symbol: CRKL
• Gene ID (NCBI): 1399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.