CRMP1 Monoclonal antibody

• 

  WB analysis of mouse cerebellum using 68021-1-Ig

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 68021-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit brain using 68021-1-Ig

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 68021-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 68021-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of chicken brain using 68021-1-Ig

  chicken brain tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig cerebellum using 68021-1-Ig

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit cerebellum using 68021-1-Ig

  rabbit cerebellum tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat cerebellum using 68021-1-Ig

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 68021-1-Ig (CRMP1 antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 68021-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68021-1-Ig (CRMP1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CRMP1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68021-1-Ig

Clone No.2F4G5

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Mouse, Rat, Rabbit, Pig, Chicken, Human and More (2)

Applications

WB, IHC, ELISA

Synonyms

CRMP 1, CRMP1, DPYSL1, DRP 1, DRP1, ULIP 3, ULIP3, Unc 33 like phosphoprotein 3

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue
• Positive IHC detected in: mouse brain tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68021-1-Ig targets CRMP1 in WB, IHC, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.

• Tested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30090

  Product name: Recombinant human CRMP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 291-537 aa of BC000252

  Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

• Full Name: collapsin response mediator protein 1
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC000252
• Gene Symbol: CRMP1
• Gene ID (NCBI): 1400
• RRID: AB_2918766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14194
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Food Chem Toxicol; Inhibiting fatty acid-binding protein 4 reverses inflammation and apoptosis in wasp sting-induced acute kidney injury; Authors - Ling Li