CRMP1 Monoclonal antibody, PBS Only

CRMP1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68021-1-PBS
Clone No.2F4G5

Host / Isotype

Mouse / IgG2a

Reactivity

Mouse, Rat, Rabbit, Pig, Chicken, Human

Applications

WB, IHC, Indirect ELISA

CRMP 1, CRMP1, DPYSL1, DRP 1, DRP1, ULIP 3, ULIP3, Unc 33 like phosphoprotein 3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68021-1-PBS targets CRMP1 in WB, IHC, Indirect ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.

Tested Reactivity Mouse, Rat, Rabbit, Pig, Chicken, Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30090

Product name: Recombinant human CRMP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 291-537 aa of BC000252

Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

Predict reactive species
Full Name collapsin response mediator protein 1
Calculated Molecular Weight 62 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberBC000252
Gene Symbol CRMP1
Gene ID (NCBI) 1400
RRIDAB_2918766
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14194
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.

Loading...
||
New chat Able
正在加载,请稍候...