CoraLite® Plus 488-conjugated CRMP1 Monoclonal antibody

CRMP1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68021
Clone No.2F4G5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

IF/ICC, FC (Intra)

2F4G5, CRMP 1, CRMP-1, Dihydropyrimidinase-related protein 1, DPYSL1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68021 targets CRMP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30090

Product name: Recombinant human CRMP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 291-537 aa of BC000252

Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

Predict reactive species
Full Name collapsin response mediator protein 1
Calculated Molecular Weight 62 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberBC000252
Gene Symbol CRMP1
Gene ID (NCBI) 1400
RRIDAB_2923861
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14194
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CRMP1 antibody CL488-68021Download protocol
IF protocol for CL Plus 488 CRMP1 antibody CL488-68021Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...