CRTAP Monoclonal antibody, PBS Only

• 

  WB analysis using 68458-1-Ig (same clone as 68458-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68458-1-Ig (CRTAP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68458-1-PBS in a different storage buffer formulation.

CRTAP Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68458-1-PBS

Clone No.2G1G6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

cartilage associated protein, CASP, CRTAP, LEPREL3

---

Product Information

68458-1-PBS targets CRTAP in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8456

  Product name: Recombinant human CRTAP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 50-401 aa of BC008745

  Sequence: HALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS

• Full Name: cartilage associated protein
• Calculated Molecular Weight: 46.5 kDa
• Observed Molecular Weight: 43-47 kDa
• GenBank Accession Number: BC008745
• Gene Symbol: CRTAP
• Gene ID (NCBI): 10491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75718
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.