Tested Applications
Positive WB detected in | PC-3 cells, MCF-7 cells |
Positive IP detected in | PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
26913-1-AP targets CSGALNACT1 in WB, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25455 Product name: Recombinant human CSGALNACT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-149 aa of BC060772 Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD Predict reactive species |
Full Name | chondroitin sulfate N-acetylgalactosaminyltransferase 1 |
Calculated Molecular Weight | 61 kDa |
Observed Molecular Weight | 61-68 kDa |
GenBank Accession Number | BC060772 |
Gene Symbol | CSGALNACT1 |
Gene ID (NCBI) | 55790 |
RRID | AB_2880682 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TDX6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
IP protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Br J Pharmacol Chondroitin sulfate proteoglycan is a potential target of memantine to improve cognitive function via the promotion of adult neurogenesis. | ||