Tested Applications
| Positive WB detected in | PC-3 cells, MCF-7 cells |
| Positive IP detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
26913-1-AP targets CSGALNACT1 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25455 Product name: Recombinant human CSGALNACT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-149 aa of BC060772 Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD Predict reactive species |
| Full Name | chondroitin sulfate N-acetylgalactosaminyltransferase 1 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 61-68 kDa |
| GenBank Accession Number | BC060772 |
| Gene Symbol | CSGALNACT1 |
| Gene ID (NCBI) | 55790 |
| RRID | AB_2880682 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDX6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
| IP protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Chondroitin sulfate proteoglycan is a potential target of memantine to improve cognitive function via the promotion of adult neurogenesis. | ||





