CSN2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30498-1-AP (same clone as 30498-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30498-1-AP (CSN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30498-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30498-1-AP (same clone as 30498-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 30498-1-AP (CSN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 30498-1-AP (same clone as 30498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 30498-1-AP (CSN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 30498-1-AP (same clone as 30498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 30498-1-AP (CSN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast hyperplasia using 30498-1-AP (same clone as 30498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 30498-1-AP (CSN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30498-1-PBS in a different storage buffer formulation.

CSN2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30498-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30498-1-PBS targets CSN2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27943

  Product name: Recombinant human CSN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-226 aa of BC096194

  Sequence: TIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV

• Full Name: casein beta
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC096194
• Gene Symbol: CSN2
• Gene ID (NCBI): 1447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05814
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSN2 is also named as Beta-casein and CASB.The β-casein is the most abundant protein in camel milk, and is one of the most important milk protein fractions  (PMID: 24973699).