CSNK2B Monoclonal antibody

• 

  WB analysis using 67866-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67866-1-Ig (CSNK2B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 67866-1-Ig

  WB result of CSNK2B antibody (67866-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CSNK2B transfected MCF-7 cells.

• 

  IHC staining of human breast cancer using 67866-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67866-1-Ig (CSNK2B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67866-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67866-1-Ig (CSNK2B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67866-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67866-1-Ig (CSNK2B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67866-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67866-1-Ig (CSNK2B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67866-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CSNK2B antibody (67866-1-Ig, Clone: 1B5A6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

CSNK2B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67866-1-Ig

Clone No.1B5A6

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Casein Kinase 2 beta, Casein kinase II subunit beta, CK II beta, CK2B, CK2N, CSK2B, CSNK2B, G5A, Phosvitin, Protein G5a

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, LNCaP cells, HeLa cells, Jurkat cells, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67866-1-Ig targets CSNK2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19180

  Product name: Recombinant human CSNK2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-215 aa of BC112017

  Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

• Full Name: casein kinase 2, beta polypeptide
• Calculated Molecular Weight: 215 aa, 25 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC112017
• Gene Symbol: CSNK2B
• Gene ID (NCBI): 1460
• RRID: AB_2918624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P67870
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSNK2B is a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. It participates in Wnt signaling, and plays a complex role in regulating the basal catalytic activity of the alpha subunit.