Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CSNK2B Monoclonal antibody

CSNK2B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67866-1-Ig
Clone No.1B5A6

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Casein Kinase 2 beta, Casein kinase II subunit beta, CK II beta, CK2B, CK2N, CSK2B, CSNK2B, G5A, Phosvitin, Protein G5a

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, MCF-7 cells, LNCaP cells, HeLa cells, Jurkat cells, pig brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67866-1-Ig targets CSNK2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19180

Product name: Recombinant human CSNK2B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-215 aa of BC112017

Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Predict reactive species
Full Name casein kinase 2, beta polypeptide
Calculated Molecular Weight 215 aa, 25 kDa
Observed Molecular Weight27 kDa
GenBank Accession NumberBC112017
Gene Symbol CSNK2B
Gene ID (NCBI) 1460
RRIDAB_2918624
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP67870
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSNK2B is a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. It participates in Wnt signaling, and plays a complex role in regulating the basal catalytic activity of the alpha subunit.

Protocols

Product Specific Protocols
IF protocol for CSNK2B antibody 67866-1-IgDownload protocol
IHC protocol for CSNK2B antibody 67866-1-IgDownload protocol
WB protocol for CSNK2B antibody 67866-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...