• Featured Product
  • KD/KO Validated

CSRP2 Polyclonal antibody, PBS Only

CSRP2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 10892-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

CRP2, Cysteine and glycine-rich protein 2, Cysteine rich protein 2, Cysteine-rich protein 2, LMO5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

10892-2-PBS targets CSRP2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1338

Product name: Recombinant human CSRP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-193 aa of BC000992

Sequence: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Predict reactive species
Full Name cysteine and glycine-rich protein 2
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC000992
Gene Symbol CSRP2
Gene ID (NCBI) 1466
RRIDAB_2087738
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16527
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CSRP2 (Cysteine and glycine-rich protein 2) is a member of the LIM-only family of cysteine-rich proteins and contains two LIM domains, which has been recently implicated in the progression and metastasis of a variety of cancers. CSRP2 is functionally linked to the activity of TGF-b1 in hepatic stellate cells (HSC), derivatives thereof, and in differentiated VSMC.CSRP2 knockdown signifcantly inhibits hypoxia-stimulated invadopodium formation, ECM degradation and invasion in MDA-MB-231 cells (PMID: 33042270). CSRP2 is a short (21 kDa) two LIM domain-containing protein, which is upregulated in invasive breast cancer cells, and localizes along the protrusive actin core of invadopodium1 (PMID: 29976963, 16735029).

Loading...
||
New chat Able
正在加载,请稍候...