CST5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human saliva using 84678-4-RR (same clone as 84678-4-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 84678-4-RR (CST5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84678-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84678-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84678-4-RR against Human CST5 were performed. The affinity constant is 0.321 nM.

CST5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84678-4-PBS

Clone No.241564A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Cystatin 5, cystatin D

---

Product Information

84678-4-PBS targets CST5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34412

  Product name: Recombinant human CST5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-142 aa of BC069514

  Sequence: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

• Full Name: cystatin D
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC069514
• Gene Symbol: CST5
• Gene ID (NCBI): 1473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28325
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CST5 (cystatin D), it is expected to be located in cytoplasmic and extracellular, and the protein is restrictively expressed at salivary gland. Human cystatin D is a novel member of the cystatin superfamily of cysteine proteinase inhibitors present in saliva and tears. The inhibitory properties displayed by cystatin D suggest that it has a function in saliva as inhibitor of either endogenous or exogenous enzymes with cathepsin S- or H-like properties (PMID: 8083219). The calculated molecular weight of CST5 is 16 kDa.