Filter: AllIHC

IHC staining of human breast cancer using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skin using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skin using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skin using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skin using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse heart using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart using 17076-1-AP (CST6 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of mouse heart using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart using 17076-1-AP (CST6 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of mouse liver using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver using 17076-1-AP (CST6 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of mouse liver using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver using 17076-1-AP (CST6 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 17076-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17076-1-AP (CST6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

CST6 Polyclonal antibody

Name: CST6 Polyclonal antibody
Brand: Proteintech
SKU: 17076-1-AP

CST6 Polyclonal Antibody for IHC, ELISA

Cat No. 17076-1-AP

Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CST6, Cystatin 6, Cystatin E, cystatin E/M, Cystatin M

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human breast cancer tissue, mouse skin tissue, mouse heart tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 2 publications below
IHC	See 1 publications below

Product Information

17076-1-AP targets CST6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10965 Product name: Recombinant human CST6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-149 aa of BC031334 Sequence: ERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM Predict reactive species
Full Name	cystatin E/M
Calculated Molecular Weight	149 aa, 17 kDa
GenBank Accession Number	BC031334
Gene Symbol	CST6
Gene ID (NCBI)	1474
RRID	AB_2878345
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15828
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CST6 antibody 17076-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse	WB	Theranostics CST6 protein and peptides inhibit breast cancer bone metastasis by suppressing CTSB activity and osteoclastogenesis Authors - Xiaoxun Li KD Validated View Article
human	WB	J Proteome Res Measurement of Organ-Specific and Acute-Phase Blood Protein Levels in Early Lyme Disease. Authors - Yong Zhou View Article
human	IHC	Int J Gen Med Predictive Values of Homeobox Gene A-Antisense Transcript 3 (HOXA-AS3), Cystatin 6 (CST6), and Chromobox Homolog 4 (CBX4) Expressions in Cancer Tissues for Recurrence of Early Colon Cancer After Surgery Authors - Xiaopeng Zhu View Article