Tested Applications
| Positive WB detected in | human saliva tissue, NIH/3T3 cells, A549 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15962-1-AP targets Cystatin A in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8733 Product name: Recombinant human CSTA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010379 Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Predict reactive species |
| Full Name | cystatin A (stefin A) |
| Calculated Molecular Weight | 98 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC010379 |
| Gene Symbol | Cystatin A |
| Gene ID (NCBI) | 1475 |
| RRID | AB_10641043 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01040 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cystatin A (CSTA) is a member of the cystatin superfamily, which are thiol proteinase inhibitors (TPI) that play crucial roles in regulating proteolytic activity. It is a small protein composed of 98 amino acids with a molecular weight of approximately 11 kDa. CSTA is primarily expressed in epithelial tissues, such as the skin and esophagus, where it serves as a precursor protein for the cornified cell envelope in keratinocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| IHC protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| WB protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cystatin A Polyclonal antibody (Cat# 15962-1-AP) has 5 citations published in Cancer Research, Journal of Allergy and Clinical Immunology, Cell Reports, Placenta, and Biochemical and Biophysical Research Communications. The associated research fields span lung cancer proteomics, allergic rhinitis and squamous metaplasia, tumor metastasis via transamidation, trophoblast biology in spontaneous abortion, and osteoclast-mediated bone resorption.
| Species | Application | Title |
|---|---|---|
J Allergy Clin Immunol The SPRR2A-CSTA axis drives IL-17A-induced squamous metaplasia and steroid resistance in allergic rhinitis. | ||
Cell Rep TGM1/3-mediated transamidation of Exo70 promotes tumor metastasis upon LKB1 inactivation | ||
Placenta Reduced level of BMI1 inhibits trophoblast proliferation and migration via the epigenetic enhancement of CSTA and TGFB2 in spontaneous abortion | ||
Biochem Biophys Res Commun CSTA plays a role in osteoclast formation and bone resorption by mediating the DAP12/TREM2 pathway
|
