Tested Applications
| Positive WB detected in | human saliva tissue, NIH/3T3 cells, A549 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15962-1-AP targets Cystatin A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8733 Product name: Recombinant human CSTA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010379 Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Predict reactive species |
| Full Name | cystatin A (stefin A) |
| Calculated Molecular Weight | 98 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC010379 |
| Gene Symbol | Cystatin A |
| Gene ID (NCBI) | 1475 |
| RRID | AB_10641043 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01040 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cystatin A (CSTA) is a member of the cystatin superfamily, which are thiol proteinase inhibitors (TPI) that play crucial roles in regulating proteolytic activity. It is a small protein composed of 98 amino acids with a molecular weight of approximately 11 kDa. CSTA is primarily expressed in epithelial tissues, such as the skin and esophagus, where it serves as a precursor protein for the cornified cell envelope in keratinocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| IHC protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| WB protocol for Cystatin A antibody 15962-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun CSTA plays a role in osteoclast formation and bone resorption by mediating the DAP12/TREM2 pathway
| ||
Cell Rep TGM1/3-mediated transamidation of Exo70 promotes tumor metastasis upon LKB1 inactivation |











