Tested Applications
| Positive WB detected in | HT-1080 cells, human testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22785-1-AP targets CTAG1B in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18784 Product name: Recombinant human CTAG1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 67-128 aa of BC130362 Sequence: GAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV Predict reactive species |
| Full Name | cancer/testis antigen 1B |
| Calculated Molecular Weight | 180 aa, 18 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC130362 |
| Gene Symbol | CTAG1B |
| Gene ID (NCBI) | 1485 |
| RRID | AB_3669404 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P78358 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CTAG1B antibody 22785-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

