CTCF Polyclonal antibody

CTCF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 30428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

11 zinc finger protein, CCCTC binding factor, CTCF, CTCFL paralog, Transcriptional repressor CTCF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, RAW 264.7 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inmouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:800-1:3200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

30428-1-AP targets CTCF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32417

Product name: Recombinant human CTCF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 562-727 aa of BC014267

Sequence: KTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR

Predict reactive species
Full Name CCCTC-binding factor (zinc finger protein)
Calculated Molecular Weight 83 kDa
Observed Molecular Weight110-150 kDa
GenBank Accession NumberBC014267
Gene Symbol CTCF
Gene ID (NCBI) 10664
RRIDAB_3086312
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49711
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcriptional insulators are DNA elements that set boundaries on the actions of enhancer and silencer elements and thereby organize the eukaryotic genome into regulatory domains. All vertebrate insulators appear to use the versatile CTCF protein. CTCF uses various combinations of its 11 zinc fingers to recognize a variety of unrelated DNA sequences. Once bound to DNA, CTCF can function as a transcriptional insulator, repressor, or activator, depending on the context of the binding site [PMID:12787766,15454938]. In vertebrates, this 11 zinc-finger protein is shown to be crucial in processes of epigenetic imprinting, X chromosome inactivation , and associated with various complex human diseases including cancer and diabetes [PMID:23139640]. The calcualted molecular weight of CTCF is 83 kDa, but stimulation of human corneal epithelial cells with hypoxic stress suppressed a high molecular mass form of CTCF (150 kDa), but not a lower molecular weight form of CTCF (130 kDa)(PMID: 22354964), and there are multiple isoforms of CTCF with molecular masses of 55, 70, 73, 80, 97, and 130 kDa have been observed (PMID: 12878173).

Protocols

Product Specific Protocols
IF protocol for CTCF antibody 30428-1-APDownload protocol
IHC protocol for CTCF antibody 30428-1-APDownload protocol
IP protocol for CTCF antibody 30428-1-APDownload protocol
WB protocol for CTCF antibody 30428-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Noncoding RNA Res

LncRNA MEG3/CTCF-CXCR4 axis functions in the regulation of breast cancer cell migration

Authors - Gusai Elhassan
Loading...
||
New chat

Able

正在加载,请稍候...