CTDSPL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CTDSPL2 Polyclonal antibody (17532-1-AP)

CTDSPL2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17532-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CTD small phosphatase-like protein 2, CTDSP like 2, CTDSP-like 2, EC:3.1.3.-, HSPC058

• 

  WB analysis of MCF-7 using 17532-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 17532-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 17532-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 17532-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 17532-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 17532-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 17532-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 17532-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 17532-1-AP

  IP result of anti-CTDSPL2 (IP:17532-1-AP, 4ug; Detection:17532-1-AP 1:500) with mouse testis tissue lysate 4400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17532-1-AP (CTDSPL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17532-1-AP (CTDSPL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17532-1-AP (CTDSPL2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 17532-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 17532-1-AP (CTDSPL2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 17532-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CTDSPL2 antibody (17532-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CTDSPL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF7 cells, HeLa cells, HepG2 cells, human brain tissue, mouse eye tissue, mouse testis tissue, Y79 cells
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse testis tissue, rat pancreas tissue, human testis tissue, mouse liver tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17532-1-AP targets CTDSPL2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11581

  Product name: Recombinant human CTDSPL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 114-466 aa of BC035744

  Sequence: EMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD

• Full Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
• Calculated Molecular Weight: 466 aa, 53 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC035744
• Gene Symbol: CTDSPL2
• Gene ID (NCBI): 51496
• RRID: AB_2087204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05D32
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTD small phosphatase-like protein 2 (CTDSPL2) is also named as HSPC058 and HSPC129, belongs to the CTDSPL2 family. It is a putative RNA-polymerase II carboxy-terminal domain (CTD) phosphatase, whose specific CTD phosphatase activity was verified in vitro, and may regulate the dynamic phosphorylation of RNAP II CTD.( PMID: 17487459) It can obviously improve the expression of ε- and γ-globin genes in K562 cells and CD34+ cells derived from UCB.( PMID: 20932329) This antibody is a rabbit polyclonal antibody raised against a region of human CTDSPL2.

Publications

What published studies show

The CTDSPL2 antibody (Cat# 17532-1-AP) has 6 total citations published in Cell Death & Disease, Cell Death Discovery, Life Sciences, Cell Cycle, Journal of Bone Oncology, and BMC Cell Biology. Research fields include oral lichen planus, non-small cell lung cancer, breast cancer paclitaxel resistance, osteosarcoma progression and regorafenib resistance, temporomandibular joint cartilage development, and globin gene expression regulation.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; MicroRNA-26a/b have protective roles in oral lichen planus.; Authors - Jie Du
human	WB,IP,IHC	Cell Death Discov; CTDSPL2 promotes the progression of non-small lung cancer through PI3K/AKT signaling via JAK1; Authors - Muzi Li ; KD Validated
mouse	WB	Life Sci; Protein phosphatase SCP4 regulates temporomandibular joint cartilage development via glucose metabolism; Authors - Jinjin Ma
human	WB,IHC,CoIP	Cell Cycle; CTDSPL2 facilitates resistance to paclitaxel in breast cancer cells by suppressing SCYL1 phosphorylation.; Authors - Jing Zhao ; KD Validated
human	WB,IHC	J Bone Oncol; The phosphatase CTDSPL2 promotes proliferation, invasion, metastasis and regorafenib resistance in osteosarcoma; Authors - Guannan Bai
human	WB	BMC Cell Biol; CTD small phosphatase like 2 (CTDSPL2) can increase ε- and γ-globin gene expression in K562 cells and CD34+ cells derived from umbilical cord blood.; Authors - Ma Yan-Ni YN