CTGF Polyclonal antibody

CTGF Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 23903-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

IBP 8, Hypertrophic chondrocyte-specific protein 24, HCS24, Cellular communication network factor 2, CCN2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse heart tissue, human heart tissue, human nephroblastoma tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23903-1-AP targets CTGF in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20985

Product name: Recombinant human CTGF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 80-156 aa of BC087839

Sequence: LFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL

Predict reactive species
Full Name connective tissue growth factor
Calculated Molecular Weight 349 aa, 38 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC087839
Gene Symbol CTGF
Gene ID (NCBI) 1490
RRIDAB_3669423
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP29279
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTGF, also known as CCN2, is a member of the CCN family of matricellular proteins. CTGF, a cysteine-rich, matrix-associated, heparin-binding protein, is widely expressed in various human tissues and organs. CTGF has important roles in many biological processes, including cell adhesion, migration, proliferation, angiogenesis, skeletal development, and tissue wound repair, and is critically involved in fibrotic disease and several forms of cancers. In western blotting, there are three different forms of CTGF reported: monomeric forms at approximately 36-38 kDa, homodimeric forms at approximately 70 kDa, and lower molecular mass fragment forms (PMID: 14592956).

Protocols

Product Specific Protocols
IHC protocol for CTGF antibody 23903-1-APDownload protocol
IP protocol for CTGF antibody 23903-1-APDownload protocol
WB protocol for CTGF antibody 23903-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Phytomedicine

Aloe-emodin ameliorated MI-induced cardiac remodeling in mice via inhibiting TGF-β/SMAD signaling via up-regulating SMAD7

Authors - Jie Yu
mouseWB,IHC

Biomater Sci

A high-density collagen xerogel thread prevents the progression of peritoneal fibrosis

Authors - Shigehisa Aoki
human,mouseWB

Ecotoxicol Environ Saf

Polystyrene microplastic-induced extracellular vesicles cause kidney-related effects in the crosstalk between tubular cells and fibroblasts

Authors - Yung-Li Wang
human,ratWB,IF

Stem Cells Int

hUMSCs Restore Uterine Function by Inhibiting Endometrial Fibrosis via Regulation of the MMP-9/TIMP-1 Ratio in CDDP-Induced Injury Rats

Authors - Yu Tang
ratWB,IHC

J Cardiovasc Transl Res

Exosomes Derived from AT2R-Overexpressing BMSC Prevent Restenosis After Carotid Artery Injury by Attenuating the Injury-Induced Neointimal Hyperplasia.

Authors - Xinliang Zou
mouseWB

Tissue Cell

Estrogen inhibits the differentiation of fibroblasts induced by high stiffness matrix by enhancing DNMT1 expression

Authors - Zhihan Zhao
Loading...
||
New chat Able
正在加载,请稍候...