Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse heart tissue, human heart tissue, human nephroblastoma tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
23903-1-AP targets CTGF in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20985 Product name: Recombinant human CTGF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 80-156 aa of BC087839 Sequence: LFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL Predict reactive species |
| Full Name | connective tissue growth factor |
| Calculated Molecular Weight | 349 aa, 38 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC087839 |
| Gene Symbol | CTGF |
| Gene ID (NCBI) | 1490 |
| RRID | AB_3669423 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29279 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CTGF, also known as CCN2, is a member of the CCN family of matricellular proteins. CTGF, a cysteine-rich, matrix-associated, heparin-binding protein, is widely expressed in various human tissues and organs. CTGF has important roles in many biological processes, including cell adhesion, migration, proliferation, angiogenesis, skeletal development, and tissue wound repair, and is critically involved in fibrotic disease and several forms of cancers. In western blotting, there are three different forms of CTGF reported: monomeric forms at approximately 36-38 kDa, homodimeric forms at approximately 70 kDa, and lower molecular mass fragment forms (PMID: 14592956).
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Aloe-emodin ameliorated MI-induced cardiac remodeling in mice via inhibiting TGF-β/SMAD signaling via up-regulating SMAD7 | ||
Biomater Sci A high-density collagen xerogel thread prevents the progression of peritoneal fibrosis | ||
Ecotoxicol Environ Saf Polystyrene microplastic-induced extracellular vesicles cause kidney-related effects in the crosstalk between tubular cells and fibroblasts | ||
Stem Cells Int hUMSCs Restore Uterine Function by Inhibiting Endometrial Fibrosis via Regulation of the MMP-9/TIMP-1 Ratio in CDDP-Induced Injury Rats | ||
J Cardiovasc Transl Res Exosomes Derived from AT2R-Overexpressing BMSC Prevent Restenosis After Carotid Artery Injury by Attenuating the Injury-Induced Neointimal Hyperplasia. | ||
Tissue Cell Estrogen inhibits the differentiation of fibroblasts induced by high stiffness matrix by enhancing DNMT1 expression |











