Product Information
27448-1-AP targets CTLA4 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24178 Product name: Recombinant human CTLA-4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 37-120 aa of BC070162 Sequence: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR Predict reactive species |
| Full Name | cytotoxic T-lymphocyte-associated protein 4 |
| Calculated Molecular Weight | 223 aa, 25 kDa |
| GenBank Accession Number | BC070162 |
| Gene Symbol | CTLA4 |
| Gene ID (NCBI) | 1493 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16410 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
