Cathepsin S Polyclonal antibody

• 

  WB analysis using 27538-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27538-1-AP (Cathepsin S antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27538-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27538-1-AP (Cathepsin S antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 27538-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27538-1-AP (Cathepsin S antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 27538-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27538-1-AP (Cathepsin S antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-87 MG using 27538-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using Cathepsin S antibody (27538-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Cathepsin S Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27538-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CTSS, EC:3.4.22.27

---

Tested Applications

• Positive WB detected in: HUVEC cells, THP-1 cells, U-87 MG cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27538-1-AP targets Cathepsin S in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25881

  Product name: Recombinant human CTSS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 179-296 aa of BC002642

  Sequence: GCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLV

• Full Name: cathepsin S
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 25 kDa, 37 kDa
• GenBank Accession Number: BC002642
• Gene Symbol: CTSS
• Gene ID (NCBI): 1520
• RRID: AB_3085966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25774
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cathepsin S (CTSS) is a cysteine protease that plays an important role in extracellular matrix degradation and remodeling, antigen presentation, inflammation, and angiogenesis; it has been identified as a radiation response gene. In malignant tumors, CTSS induces tumor proliferation, invasion and metastasis through various mechanisms. CTSS proteins could be detected in two forms, pro-CTSS (35-37 kDa) and active CTSS (25 kDa) (PMID: 30006610, PMID: 34208434). And in this publication, it was also reporeted that active CTSS was expressed at higher levels than pro-CTSS in the lysate (PMID: 34208434).