CX3CL1 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 10108-2-AP (same clone as 10108-2-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10108-2-AP (CX3CL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10108-2-AP (same clone as 10108-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10108-2-AP (CX3CL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 10108-2-AP (same clone as 10108-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10108-2-AP (CX3CL1 antibody) at dilution of 1:400 (under 10x lens).. This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 10108-2-AP (same clone as 10108-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10108-2-AP (CX3CL1 antibody) at dilution of 1:400 (under 40x lens).. This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 10108-2-AP (same clone as 10108-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 10108-2-AP (CX3CL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 10108-2-AP (same clone as 10108-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 10108-2-AP (CX3CL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10108-2-PBS in a different storage buffer formulation.

CX3CL1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10108-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, C3Xkine, C X3 C motif chemokine 1, ABCD 3

---

Product Information

10108-2-PBS targets CX3CL1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0161

  Product name: Recombinant human CX3CL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-245 aa of BC001163

  Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ

• Full Name: chemokine (C-X3-C motif) ligand 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC001163
• Gene Symbol: CX3CL1
• Gene ID (NCBI): 6376
• RRID: AB_2087154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78423
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chemokines direct the trafficking of white blood cells in immune surveillance, playing a key role in inflammatory and infectious diseases such as AIDS. The human CX3C chemokine carries the chemokine domain on top of an extended mucin-like stalk. CX3CL1 is synthesized as a 50-75 kDa precursor and undergoes glycosylation to yield two mature forms: a 100 kDa cell membrane bound form and an 85 kDa soluble form which is released from the cell surface. The soluble CX3C chemokine has potent chemoattractant activity for T cells and monocytes, and the cell-surface-bound protein, which is induced by primary proinflammatory signals in activated primary endothelial cells, promotes strong adhesion of those leukocytes.