Product Information
60685-2-PBS targets CXCL1 as part of a matched antibody pair:
MP50987-1: 60685-1-PBS capture and 60685-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16761 Product name: Recombinant human CXCL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-107 aa of BC011976 Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Calculated Molecular Weight | 8 kDa to 14 kDa |
| GenBank Accession Number | BC011976 |
| Gene Symbol | CXCL1 |
| Gene ID (NCBI) | 2919 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P09341 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

