CXCL1 Recombinant monoclonal antibody, PBS Only (Capture)

CXCL1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83937-1-PBS
Clone No.240990E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

C X C motif chemokine 1, C-X-C motif chemokine 1, CXCL 1, GRO-alpha(4-73), GRO-alpha(5-73)

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83937-1-PBS targets CXCL1 as part of a matched antibody pair:

MP00922-2: 83937-1-PBS capture and 83937-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2917

Product name: Recombinant human CXCL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-107 aa of BC011976

Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Calculated Molecular Weight 8 kDa to 14 kDa
GenBank Accession NumberBC011976
Gene Symbol CXCL1
Gene ID (NCBI) 2919
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09341
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.

Loading...
||
New chat Able
正在加载,请稍候...