Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human renal cell carcinoma tissue, human breast cancer tissue, human lymphoma tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | TT cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 16 publications below |
| IF | See 7 publications below |
Product Information
10927-1-AP targets CXCL13/BCA1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1358 Product name: Recombinant human CXCL13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC012589 Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 13 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC012589 |
| Gene Symbol | CXCL13/BCA1 |
| Gene ID (NCBI) | 10563 |
| RRID | AB_2086050 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43927 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BLR1 (Burkitt lymphoma receptor-1), also called CXCR5, is highly expressed on Burkitt lymphoma cells and B lymphocytes. It may therefore function in the homing of B lymphocytes to follicles. It was reported that the B cell chemokine CXCL13 is elevated in MS serum and cerebrospinal fluid. CXCL13 is also regarded as a proposed serum biomarker of synovitis in RA( Rheumatoid arthritis). CXCL13 consists of a 22-aa signal peptide and a 87-aa mature poly-peptide.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCL13/BCA1 antibody 10927-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv Defined lifestyle and germline factors predispose Asian populations to gastric cancer. | ||
Nat Commun B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma. | ||
Genomics MIN score predicts primary response to infliximab/adalimumab and vedolizumab therapy in patients with inflammatory bowel diseases. | ||
Aging (Albany NY) Immune profiling reveals prognostic genes in high-grade serous ovarian cancer. | ||
J Immunol Villitis of unknown etiology is associated with a distinct pattern of chemokine up-regulation in the feto-maternal and placental compartments: implications for conjoint maternal allograft rejection and maternal anti-fetal graft-versus-host disease. | ||
Front Immunol A Standardized Analysis of Tertiary Lymphoid Structures in Human Melanoma: Disease Progression- and Tumor Site-Associated Changes With Germinal Center Alteration. |

























