Anti-Mouse CXCL2 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of RAW 264.7 using 98259-1-RR (same clone as 98259-1-PBS)

  1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.

• 

  FC experiment of RAW 264.7 using 98259-1-RR (same clone as 98259-1-PBS)

  1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98259-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98259-1-RR against Mouse CXCL2 were performed. The affinity constant is below 1 pM.

CXCL2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98259-1-PBS

Clone No.242007G5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2

---

Product Information

98259-1-PBS targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2239

  Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 28-100 aa of NM_009140

  Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

• Full Name: chemokine (C-X-C motif) ligand 2
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NM_009140
• Gene Symbol: Cxcl2
• Gene ID (NCBI): 20310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10889
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays an critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).