Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse CXCL2 Rabbit Recombinant Antibody, PBS Only (98259-1-PBS)

Anti-Mouse CXCL2 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Mouse CXCL2 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98259-1-PBS-1MG

CXCL2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98259-1-PBS

Clone No. 242007G5

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of RAW 264.7 using 98259-1-RR (same clone as 98259-1-PBS)
1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.
FC experiment of RAW 264.7 using 98259-1-RR (same clone as 98259-1-PBS)
1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98259-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 98259-1-RR
Biolayer interferometry (BLl) kinetic assays of 98259-1-RR against Mouse CXCL2 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL2 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98259-1-PBS targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species
Full Name	chemokine (C-X-C motif) ligand 2
Calculated Molecular Weight	11 kDa
GenBank Accession Number	NM_009140
Gene Symbol	Cxcl2
Gene ID (NCBI)	20310
RRID	AB_3719955
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P10889
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).