Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR)

Anti-Mouse CXCL2 Rabbit Recombinant Antibody

CXCL2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98259-1-RR

Clone No. 242007G5

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

242007G5, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2, Mip-2

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 647 CoraLite®594 FITC Plus

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of RAW 264.7 using 98259-1-RR
1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of RAW 264.7 using 98259-1-RR
1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit RecAb (98259-1-RR, Clone: 242007G5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse CXCL2 Rabbit Recombinant Antibody (98259-1-RR, Clone: 242007G5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
Affinity and Kinetic Characterization of 98259-1-RR
Biolayer interferometry (BLl) kinetic assays of 98259-1-RR against Mouse CXCL2 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL2 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC (Intra) detected in

LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98259-1-RR targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species
Full Name	chemokine (C-X-C motif) ligand 2
Calculated Molecular Weight	11 kDa
GenBank Accession Number	NM_009140
Gene Symbol	Cxcl2
Gene ID (NCBI)	20310
RRID	AB_3719955
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P10889
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).

Protocols

Product Specific Protocols
FC protocol for CXCL2 antibody 98259-1-RR	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Anti-Mouse CXCL2 Rabbit Recombinant Antibody (Cat# 98259-1-RR) has 2 citations. Both studies used flow cytometry in mouse models. One appeared in Science Advances, investigating cytoskeletal remodeling and mitochondrial transfer in cardiac cells during sepsis. The other was published in Research, examining splenic PD-L1(+) myeloid-derived suppressor cells and their contact-dependent effects on alveolar macrophage dysfunction in early sepsis. The associated research fields are cardiovascular biology and immunology, both in the context of sepsis.

Species	Application	Title
mouse	FC	Sci Adv Cytoskeletal remodeling promotes tunneling nanotube formation and drives cardiac resident cell mitochondrial transfer in sepsis. Authors - Rui Song View Article
mouse	FC	Research (Wash D C) Splenic PD-L1(+) Myeloid-Derived Suppressor Cells Induce Contact-Dependent Alveolar Macrophage Dysfunction in Early Sepsis. Authors - Bing Xie View Article