CXCL3/GRO Gamma Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of RAW 264.7 using 86261-1-RR (same clone as 86261-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 86261-1-RR (CXCL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86261-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86261-1-RR (same clone as 86261-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86261-1-RR (CXCL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86261-1-PBS in a different storage buffer formulation.

CXCL3/GRO Gamma Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86261-1-PBS

Clone No.250114C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CXCL/GRO Gamma, CXCL3, C X C motif chemokine 3, C-X-C motif chemokine 3, GRO gamma

---

Product Information

86261-1-PBS targets CXCL3/GRO Gamma in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2982

  Product name: recombinant human CXCL3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 35-107 aa of NM_002090.3

  Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

• Full Name: chemokine (C-X-C motif) ligand 3
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_002090.3
• Gene Symbol: CXCL3
• Gene ID (NCBI): 2921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19876
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression.