CXCL3/GRO Gamma Recombinant monoclonal antibody

• 

  WB analysis of RAW 264.7 using 86261-1-RR

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 86261-1-RR (CXCL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86261-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86261-1-RR (CXCL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CXCL3/GRO Gamma Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86261-1-RR

Clone No.250114C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CXCL/GRO Gamma, CXCL3, C X C motif chemokine 3, C-X-C motif chemokine 3, GRO gamma

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, A549 cells, rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86261-1-RR targets CXCL3/GRO Gamma in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2982

  Product name: recombinant human CXCL3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 35-107 aa of NM_002090.3

  Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

• Full Name: chemokine (C-X-C motif) ligand 3
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_002090.3
• Gene Symbol: CXCL3
• Gene ID (NCBI): 2921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19876
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression.