Anti-Human CXCL4/PF4 Rabbit Recombinant Antibody, PBS Only

CXCL4/PF4 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98410-2-PBS
Clone No.243087D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98410-2-PBS targets CXCL4/PF4 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2129

Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 32-101 aa of NM_002619.4

Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Predict reactive species
Full Name platelet factor 4
Calculated Molecular Weight11 kDa
GenBank Accession NumberNM_002619.4
Gene Symbol PF4
Gene ID (NCBI) 5196
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02776
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CXCL4, also known as platelet factor 4 (PF-4), is the oldest member of the chemokine family. CXCL4 is a chemokine produced by activated platelets and immune cells involved in pathological conditions such as cancer, infections and inflammatory diseases like systemic sclerosis (SSc), rheumatoid arthritis (RA) and psoriatic arthritis (PsA), among others. CXCL4 is present in the α-granules of platelets in amounts that constitute up to 2% platelet protein mass. CXCL4 plays a determinant role in distinct physiological processes such as in hematopoiesis, angiogenesis, coagulation and modulation of immune responses. For instance, CXCL4 can prevent monocyte apoptosis and promote cell survival, induces the production of TNF and reactive oxygen species (ROS) and promotes monocyte differentiation into a unique macrophage-like phenotype.

Loading...
||
New chat Able
正在加载,请稍候...