Product Information
10809-1-PBS targets LIX/CXCL5 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1079 Product name: Recombinant human CXCL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC008376 Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 5 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC008376 |
| Gene Symbol | CXCL5 |
| Gene ID (NCBI) | 6374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42830 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.







