CXCL8/IL-8 Polyclonal antibody, PBS Only

• 

  WB analysis using 31533-1-AP (same clone as 31533-1-PBS)

  Untreated, PMA, LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 31533-1-AP (CXCL8/IL-8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 31533-1-AP (same clone as 31533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 31533-1-AP (CXCL8/IL-8 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 31533-1-AP (same clone as 31533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 31533-1-AP (CXCL8/IL-8 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31533-1-AP (same clone as 31533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31533-1-AP (CXCL8/IL-8 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31533-1-AP (same clone as 31533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31533-1-AP (CXCL8/IL-8 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 31533-1-AP (same clone as 31533-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated THP-1 cells using CXCL8/IL-8 antibody (31533-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31533-1-PBS in a different storage buffer formulation.

CXCL8/IL-8 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31533-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CXCL8, IL8, IL-8, C X C motif chemokine 8, Chemokine

---

Product Information

31533-1-PBS targets CXCL8/IL-8 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0152

  Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 28-99 aa of BC013615

  Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

• Full Name: interleukin 8
• Calculated Molecular Weight: 99 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC013615
• Gene Symbol: IL-8
• Gene ID (NCBI): 3576
• ENSEMBL Gene ID: ENSG00000169429
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P10145
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa).