Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody, PBS Only

CXCL8/IL-8 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98137-1-PBS
Clone No.240889B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

CXCL8, IL8, IL-8, 240889B2, C X C motif chemokine 8

Formulation:  PBS Only
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98137-1-PBS targets CXCL8/IL-8 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0152

Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 28-99 aa of BC013615

Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Predict reactive species
Full Name interleukin 8
Calculated Molecular Weight 99 aa, 11 kDa
GenBank Accession NumberBC013615
Gene Symbol IL-8
Gene ID (NCBI) 3576
ENSEMBL Gene IDENSG00000169429
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10145
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression.

Loading...
||
New chat

Able

正在加载,请稍候...