CXCL8/IL-8 Polyclonal antibody

CXCL8/IL-8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27095-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

CXCL8, IL8, IL-8, C X C motif chemokine 8, Chemokine

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPMA, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27095-1-AP targets CXCL8/IL-8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25640

Product name: Recombinant human CXCL8/IL-8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 40-99 aa of BC013615

Sequence: YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Predict reactive species
Full Name interleukin 8
Calculated Molecular Weight 99 aa, 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC013615
Gene Symbol IL-8
Gene ID (NCBI) 3576
ENSEMBL Gene IDENSG00000169429
RRIDAB_2861340
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10145
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 8 (IL-8), also known as CXCL8, which is a member of the CXC chemokine family. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa).

Protocols

Product Specific Protocols
IF protocol for CXCL8/IL-8 antibody 27095-1-APDownload protocol
IHC protocol for CXCL8/IL-8 antibody 27095-1-APDownload protocol
WB protocol for CXCL8/IL-8 antibody 27095-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
IHC

Adv Sci (Weinh)

Traditional Chinese Medicine Formulae QY305 Reducing Cutaneous Adverse Reaction and Diarrhea by its Nanostructure

Authors - Ya-Li Zhang
humanWB

Gut Microbes

Fusobacterium nucleatum promotes esophageal squamous cell carcinoma progression and chemoresistance by enhancing the secretion of chemotherapy-induced senescence-associated secretory phenotype via activation of DNA damage response pathway

Authors - Jian-Wei Zhang
humanIF

Acta Pharmacol Sin

Calcipotriol abrogates cancer-associated fibroblast-derived IL-8-mediated oxaliplatin resistance in gastric cancer cells via blocking PI3K/Akt signaling.

Authors - Zhen-Xiong Zhao
WB

iScience

Analysis of microbiota reveals the underlying mechanism of PHF11 in the development of Enterococcus-regulated endometriotic cysts

Authors - Jingjing Hu
WB

Int Immunopharmacol

Aflatoxin B1 exposure triggers inflammation and premature skin aging via ERMCS/Ca2+/ROS signaling cascade

Authors - Deyi Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Maggie (Verified Customer) (12-08-2025)

Overnight incubation at 4°C. Secondary antibody incubation for 1 hr at RT.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: CWR22Rv1 Human Prostate Cancer Cells
CXCL8/IL-8 Antibody Immunofluorescence validation (1:200 dilution) in CWR22Rv1 Human Prostate Cancer Cells (Cat no:27095-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...