Anti-Mouse CXCR2 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CXCR2 Rabbit Recombinant Antibody (98353-4-RR)

• 

  FC experiment of mouse bone marrow cells using 98353-4-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CXCR2 Rabbit RecAb (98353-4-RR, Clone: 242766G3) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Mouse Ly-6G/Ly-6C (Gr-1). Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using 98353-4-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CXCR2 Rabbit RecAb (98353-4-RR, Clone: 242766G3) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

CXCR2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98353-4-RR

Clone No.242766G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD182, Cmkar2, C-X-C chemokine receptor type 2, CXC-R2, CXCR-2

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98353-4-RR targets CXCR2 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2228

  Product name: Recombinant Mouse CXCR2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-47 aa of NM_009909.3

  Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS

• Full Name: interleukin 8 receptor, beta
• Calculated Molecular Weight: 40 kDa
• GenBank Accession Number: NM_009909.3
• Gene Symbol: Cxcr2
• Gene ID (NCBI): 12765
• RRID: AB_3746003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35343
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCR2, also named as CD182, Cmkar2, Gpcr16, or Il8rb, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.