Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, mouse liver tissue |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 12 publications below |
| IHC | See 4 publications below |
| IF | See 9 publications below |
Product Information
26756-1-AP targets CXCR3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25056 Product name: Recombinant human CXCR3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 3 |
| Calculated Molecular Weight | 368 aa, 41 kDa |
| Observed Molecular Weight | 41kDa, 70 kDa |
| GenBank Accession Number | BC034403 |
| Gene Symbol | CXCR3 |
| Gene ID (NCBI) | 2833 |
| RRID | AB_2880623 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCR3 (C-X-C chemokine receptor type 3) is a G-protein-coupled seven-transmembrane domain chemokine receptor that is expressed on the surface of a number of cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells. CXCR3 is activated by three related chemokines (CXCL9, CXCL10, and CXCL11) and plays an important role in effector T-cell and NK cell trafficking. CXCR3 has three isoforms termed CXCR3-A, CXCR3-B, and CXCR3-alt with the calculated molecular mass of 41kDa, 46kDa, and 29kDa respectively. The apparent molecular mass of CXCR3 detected by some scientists is 70kDa, but 45kDa by others. (PMID: 16847335, 15150261, 22885102, 19151743)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCR3 antibody 26756-1-AP | Download protocol |
| WB protocol for CXCR3 antibody 26756-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioeng Transl Med Therapeutic potential of nanoceria pretreatment in preventing the development of urological chronic pelvic pain syndrome: Immunomodulation via reactive oxygen species scavenging and SerpinB2 downregulation | ||
J Ethnopharmacol Rubia cordifolia L. extract ameliorates vitiligo by inhibiting the CXCL10/CXCL9/STAT1 signaling pathway | ||
Int Immunopharmacol Inhibition of LCP2 in T cells alleviated apoptosis and oxidative stress via PD-1/PD-L1 in diabetic retinopathy | ||
J Cell Sci Gap junction-mediated MiR-200b on osteogenesis and angiogenesis in coculture between MSCs and HUVECs. | ||
J Immunol A Novel TrxR1 Inhibitor Regulates NK and CD8+ T Cell Infiltration and Cytotoxicity, Enhancing the Efficacy of Anti-PD-1 Immunotherapy against Hepatocarcinoma | ||
Front Pharmacol Paeonol Ameliorates Chronic Itch and Spinal Astrocytic Activation via CXCR3 in an Experimental Dry Skin Model in Mice. |







