Product Information
84506-2-PBS targets CXCR4 in Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2231 Product name: Recombinant Mouse CXCR4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-40 aa of NM_009911.3 Sequence: MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNR Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 4 |
| Calculated Molecular Weight | 40kDa |
| GenBank Accession Number | NM_009911.3 |
| Gene Symbol | Cxcr4 |
| Gene ID (NCBI) | 12767 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P70658 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
