Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells, mouse spleen tissue, rat spleen tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28239-1-AP targets CXCR5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28271 Product name: Recombinant human CXCR5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 241-372 aa of NM_001716 Sequence: MVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 5 |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | NM_001716 |
| Gene Symbol | CXCR5 |
| Gene ID (NCBI) | 643 |
| RRID | AB_3086040 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P32302 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Initially discovered in 1992 as Burkitt's lymphoma receptor 1, CXCR5 (chemokine receptor 5, also known as CD185) is a seven-transmembrane G protein-coupled receptor (GPCR) protein (PMID: 32994482). CXCR5 is essential for naïve B-cell migration to and maturation in the lymph nodes and spleen, as well as for cluster of differentiation 4 T-cell (TFH and TCM) homing and interaction with B cells (PMID: 21471443). Moreover, CXCR5 is involved in the regulation of neural stem cells (NSC) and neuronal regeneration in the mouse brain, neuronal differentiation, neurogenesis, gliogenesis, and synaptogenesis (PMID: 37460877).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCR5 antibody 28239-1-AP | Download protocol |
| WB protocol for CXCR5 antibody 28239-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





