Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells |
| Positive IHC detected in | mouse heart tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
22357-1-AP targets CXorf15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17936 Product name: Recombinant human CXorf15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 447-528 aa of BC101576 Sequence: ELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIESVD Predict reactive species |
| Full Name | chromosome X open reading frame 15 |
| Calculated Molecular Weight | 528 aa, 61 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC101576 |
| Gene Symbol | CXorf15 |
| Gene ID (NCBI) | 55787 |
| RRID | AB_2879087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9NUQ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXorf15 antibody 22357-1-AP | Download protocol |
| IHC protocol for CXorf15 antibody 22357-1-AP | Download protocol |
| WB protocol for CXorf15 antibody 22357-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









