Tested Applications
Positive WB detected in | HeLa cells |
Positive IHC detected in | human placenta tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 3 publications below |
Product Information
25708-1-AP targets KK-LC-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22619 Product name: Recombinant human CXorf61 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-113 aa of BC062223 Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST Predict reactive species |
Full Name | chromosome X open reading frame 61 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC062223 |
Gene Symbol | KK-LC-1 |
Gene ID (NCBI) | 203413 |
RRID | AB_2880203 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5H943 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. The molecular mass of KK-LC-1 is 13 kDa. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KK-LC-1 antibody 25708-1-AP | Download protocol |
IHC protocol for KK-LC-1 antibody 25708-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int Immunopharmacol Integrative analysis-based identification and validation of a prognostic immune cell infiltration-based model for patients with advanced gastric cancer. | ||
Nat Commun KK-LC-1 as a therapeutic target to eliminate ALDH+ stem cells in triple negative breast cancer | ||
Cancer Immunol Immunother Integrating bulk and single-cell sequencing data to construct a Scissor+ dendritic cells prognostic model for predicting prognosis and immune responses in ESCC |